11-26-07: Gene/CDS feature created
gene
5423493..5424341
/locus_tag="PSPTO_5631"
CDS
5423493..5424341
/locus_tag="PSPTO_5631"
/inference=”similar to AA sequence(same species):INSD:AAO57223.1”
/codon_start=1
/transl_table=11
/product="hypothetical protein"

11-26-07: Gene name, product name, and note changed - Inference added
/gene="mgoA"
/note="This enzyme consists of an amino acid activation and ligation domain followed by a thiolation domaintypical of non-ribosomal peptide synthetases; similar to the ornithine acetyl transferase inhibitor mangotoxin; see PMID:17506328"
/product="ornithine acetyl transferase inhibitor"
/inference="similar to AA sequence(same species):INSD:ABG00046.1"

M. Lindeberg
Cornell University
Based on literature review

11-26-07: Miscellaneous feature created
misc_feature
899534..960280
/note="ICEland; putative integrative and conjugative element, degenerate; includes genes for type III effectors HopAJ1, HopAT1’, HopD1, HopQ1-1, and HopR1”
/inference=”similar to DNA sequence(same species):INSD:AJ870974.1”

9-06-07: Coordinates changed
Coordinates for PSPTO_4574 changed from 5170504..5171616 to 5169133..5171616. Translated product changed accordingly.

9-06-07: Coordinates and note field changed
gene          
5355978..5356022
/locus_tag="PSPTO_5623"
/note="This region contains an authentic frame shift and is not the result of a sequencing artifact; This gene is disrupted by an IS element insertion.; HopH protein, interruption-N; identified by sequence similarity; putative"
/pseudo

9-06-07: Gene and CDS features added
gene
191660..192508
/locus_tag="PSPTO_5630"
CDS
191660..192508
/locus_tag="PSPTO_5630"
/note="similar to gb:AAO55966; identified by sequence similarity; putative"
/codon_start=1
/transl_table=11
/product="hypothetical protein"

12-13-06: Change in coordinates and assignment of gene and product name
gene            2367818..2369452
/gene="pvdP"
/locus_tag="PSPTO_2157"
/old_locus_tag=PSPTO2157
CDS             2367818..2369452
/gene="pvdP"
/locus_tag="PSPTO_2157"
/note="similar to SP:Q9I188; identified
by sequence similarity; putative"
/codon_start=1
/transl_table=11
product="PvdP; Tat (twin-arginine translocation) pathway signal
sequence domain protein"
/protein_id="AAO53621.1"
/db_xref="GI:28850541"
/translation="MTISRRGFMAGLALTGAALPAAYYAHRELTRVEEPVTPGEATAGPADTATQR
LADKLRGVWTLRFEGRDAGLSGAPLQGLEMFLDIAPRGRGLRGYIDTAEQLRGEGMPRFR
VIGDLQPNAAKLYLRVMDGHAGNDPHSDTPDYEFSLTLDEVWGAFGNAGSGTLSGRVERL
DRPLALPELENRLIAIKQVFPEARERVALSPPFLAWLVSREHRLFHQLWHASRDKWHKLPE
DKRDARGIGWQPGPRDKERDARGPRKDRNGSGEDFFYMHRHMLIQARKIQDLPSWPRF
PLPQPEERDRLGFARYFDNHDGCALPPNWLAQGDEEYTQLVSDIKSHETYHTHFEVWES
QYRDPLSKLTLGQFGSQVELELHDWLHMRWASVARDPANGQPVPMARRSDDFAERWFE
PENDFDPFSSHVNPVFWMFHGWIDDRIDDWFRAHERFHPGEVKRLDVNGVPWFAPGRW
VEVSDPWLGPETHGCSTVPGQTAGTTMEMDPEVMKLALRITFAADDKLSNLLRRVPRRPW
YARNLLPERWF"

11-21-06: CDS feature added and pseudogene designation removed
/product="ribosomal large subunit pseudouridine synthase D"

9-22-06: New CDS feature
5350102..5350647
/gene="hopD"
/locus_tag="PSPTO_4724"
/note="This region contains an authentic frame shift and is not the result of a sequencing artifact; This gene is disrupted by an IS element insertion.; HopD protein, interruption-N; previously known as HopPtoD-related; similar to GP:11322461; identified by sequence similarity; putative"
/codon_start=1 /transl_table=11
/product="type III effector HopD"
/protein_id="ABI93937.1"
/db_xref="GI:115313959"
/translation="MNPLQSTQHSITTPLISGGRPLDAVGPQAQQSHPKRISPSQLSP GAHQALKRPSANAEHQRIASLVRNALQDGTLQFQSSNDKQVTYKAPVCLPADTSTDTD TDTVRTERLINNELTVQARLNDQSEYDIVSAHLHGSSRSISFDVPSPPPAHGSASSAL SERTHLGRRCKNSQLSPPLAH"

M. Lindeberg
Cornell University

M. Lindeberg
Cornell University

5-06: Gene, product name, and functional information added
Gene name "tvrR" added. Product name changed from "transcriptional regulator, TetR family" to "TetR-like virulence regulator".

”mutations exhibit reduced disease symptoms and growth in planta; PMID 16267304” added to note qualifier

M. Lindeberg
Cornell University
Based on literature review

5-06: Functional information added

M. Lindeberg
Cornell University
Based on literature review

3-06: Gene feature added
gene
complement(922509..922756)
/gene="hopAT1"
/locus_tag="PSPTO_5618"
/note="type III effector protein hopAT1; this region contains premature stop codons or frameshifts;
identified by sequence similarity, degenerate; similar to PSPPH_5225
(GI:76008346)"
/pseudo

11-05: Gene name added
Gene name "copA" added. Based on experimental evidence in Pst DC3000

11-05: Gene name added
Gene name "plcA1" added. Based on experimental evidence in Pst DC3000

3-05: Nomenclature
Gene name changed from "avrE(Pto)" to "avrE1". Product name changed from "avirulence protein AvrE(Pto)" to "type III effector protein AvrE1". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "avrPto(DC3000)" to "avrPto1". Product name changed from "avirulence protein AvrPto(DC3000)" to "type III effector protein AvrPto1". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPsyA(Pto)" to "hopA1". Product name changed from "type III effector HopPsyA(Pto)" to "type III effector HopA1"
Note changed to: "previously known as HrmA (PMID 8274770; Heu and Hutcheson, 1993) and HopPsyA (PMID 11854524; Fouts et al, 2002); similar to SP:Q08370, GB:L05500, SP:Q08828, and PID:349269; identified by sequence similarity; putative". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoB1" to "hopB1". Product name changed from "type III effector HopPtoB1" to "type III effector HopB1". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoC" to "hopC1". Product name changed from "type III effector HopPtoC" to "type III effector HopC1"
Note changed to: "previously known as HopPtoC (PMID 12032338; Petnicki-Ocwieja et al, 2002).. Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoD1" to "hopD1". Product name changed from "type III effector HopPtoD1" to "type III effector HopD1"
Note changed to: "previously known as HopPtoD1 (PMID 12032338; Petnicki-Ocwieja et al, 2002); similar to GP:14905934; identified by sequence similarity; putative". Reference (PMID: 15828679)

3-05: Nomenclature
Note changed to: "This region contains an authentic frame shift and is not the result of a sequencing artifact; This gene is disrupted by an IS element insertion.; HopD protein, interruption-N; previously known as HopPtoD-related; similar to GP:11322461; identified by sequence similarity; putative". Reference (PMID: 15828679)

3-05: Nomenclature
Note changed to: "This region contains an authentic frame shift and is not the result of a sequencing artifact; This gene is disrupted by an IS element insertion.; HopD protein, interruption-C; similar to GP:14905934; previously known as HopPtoD-related; identified by sequence similarity; putative". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoE" to "hopE1". Product name changed from "type III effector HopPtoE" to "type III effector HopE1"
Note changed to: "previously known as HolPtoV (PMID 11872842; Guttman et
al, 2002) and HopPtoE (PMID 12032338; Petnicki-Ocwieja et al, 2002)." Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoF" to "hopF2". Product name changed from "type III effector HopPtoF" to "type III effector HopF2"
Note changed to: "This gene has an isoleucine start. Previously known as HolPtoAD (PMID 11872842; Guttman et al, 2002) and HopPtoF (PMID 11854524; Fouts et al, 2002); similar to GP:7677395; identified by sequence similarity; putative". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoG" to "hopG1". Product name changed from "type III effector HopPtoG" to "type III effector HopG1"
Note changed to: "Previously known as HolPtoW (PMID 11872842; Guttman et
al, 2002) and HopPtoG (PMID 12032338; Petnicki-Ocwieja et al, 2002).". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoH" to "hopH1". Product name changed from "type III effector HopPtoH" to "type III effector HopH1"
Note added: "Previously known as HopPtoH (PMID 12032338; Petnicki-Ocwieja et al, 2002).". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoI" to "hopAD1". Product name changed from "type III effector HopPtoI" to "type III effector HopAD1"
Note changed to: "Previously known as and HolPtoS (PMID 11872842; Guttman et al, 2002) and HopPtoI (PMID 12032338; Petnicki-Ocwieja et al, 2002); identified by match to PFAM protein family HMM PF02918". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoJ" to "hopAF1". Product name changed from "type III effector HopPtoJ" to "type III effector HopAF1"
Note added: "Previously known as HolPtoN (PMID 11872842; Guttman et
al, 2002) and HopPToJ (PMID 12032338; Petnicki-Ocwieja et al, 2002)" . Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoK" to "hopK1". Product name changed from "type III effector HopPtoK" to "type III effector HopK1"
Note changed to: "Previously known as HopPtoK (PMID 12032338; Petnicki-Ocwieja et al, 2002) and HolPtoAB (PMID 11872842; Guttman et al, 2002); similar to GP:1008894; identified by sequence similarity; putative". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoL" to "hopL1". Product name changed from "type III effector HopPtoL" to "type III effector HopL1"
Note added: "Previously known as HopPtoL (PMID 12032338; Petnicki-Ocwieja et al, 2002)". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoM" to "hopM1". Product name changed from "type III effector HopPtoM" to "type III effector HopM1"
Note changed to: "Previously known as CEL ORF3 (PMID 10781092; Alfano et
al, 2000), HolPtoX (PMID 11872842; Guttman et al,
2002), HopPtoM (PMID 12940984; Badel et al, 2003); similar to GP:8037794; identified by sequence similarity; putative". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name changed from "hopPtoN" to "hopN1". Product name changed from "type III effector HopPtoN" to "type III effector HopN1".
Note changed to: "Previously known as CEL ORF7 (PMID 10781092; Alfano et
al, 2000), HolPtoT (PMID 11872842; Guttman et al,
2002), and HopPtoN (PMID 15469508; Lopez-Solanilla, et al, 2004); identified by match to TIGR protein family HMM TIGR01586". Reference (PMID: 15828679)

3-05: Nomenclature
Gene name added: "hopO1-3"
Product name changed from "HopPtoO-related protein" to "type III effector HopO1-3"
Note added: "This region contains an authentic point mutation causing a premature stop and is not the result of a sequencing artifact; identified by similarity to the N-terminal regions of HopO1-1 and HopO1-2. ". Reference (PMID: 15828679)

3-05: Nomenclature
Region designated as: "misc_feature"
Note added: "This region contains an authentic point mutation causing a premature stop and is not the result of a sequencing artifact; identified by similarity to the C-terminal regions of HopO1-1 and HopO1-2. ". Reference (PMID: 15828679)