Updates to the Pto DC3000 pDC3000A sequence and annotation:

LocusDate: Nature of changeSource
PSPTO_A0005 9-06: Nomenclature correction
Gene name changed from "hopAM1-1" to "hopAM1-2". Product name changed from "type III effector HopAM1-1" to "type III effector HopAM1-2"		 M. Lindeberg,
Cornell University
  9-06: Promoter feature added
promoter        complement(6595.. 6627)
                   /note="hrp box; putative HrpL-dependent promoter; location
                   identified by hidden Markov model and/or weight matrix
                   scans; downstream gene(s) exhibit HrpL-dependent
                  differential expression"
                   /experiment="microarray and/or RT-PCR"		 D. Schneider,
USDA-ARS
  9-06: Promoter feature added
promoter        complement(16103..16135)
                   /note="hrp box; putative HrpL-dependent promoter; location
                   identified by hidden Markov model and/or weight matrix
                   scans; downstream gene(s) exhibit HrpL-dependent
                  differential expression"
                   /experiment="microarray and/or RT-PCR"		 D. Schneider,
USDA-ARS
  9-06: Promoter feature added
promoter       19658.. 19690
                   /note="hrp box; putative HrpL-dependent promoter; location
                   identified by hidden Markov model and/or weight matrix
                   scans; downstream gene(s) exhibit HrpL-dependent
                  differential expression"
                   /experiment="microarray and/or RT-PCR"		 D. Schneider,
USDA-ARS
PSPTOA0072

5-18-06: Gene and CDS features added

gene            3564..5705                    
/locus_tag="PSPTO_A0072"    

CDS             3564..5705                    
/locus_tag="PSPTO_A0072"                    
/note="similar to GP:9187579; identified by sequence similarity; putative"                    
/codon_start=1                    
/transl_table=11                    
/product="site-specific recombinase, phage integrase family"                    
/translation="MSYVPFDVDHYERQEKLSDLERTILSNRRYRSDWAYLQSSVPRLVIPLIDL
VAHAGVSDRLAVSSVSVILWHVSRTDIPYWSWSEMQWLALLDTQAGSRPYLAAVAYHMG
GFRTPQRITKFRQSAIYASFIFGHKIFKDELTRLSTVLKSLGYTARHLEKFLSSVLGALILEN
GDPRLETFTEGLLIKGQGHRSVGIARLVGKVSHGLAALGILDKPLRKRGYADWREKSIEGI
DPVWVSWCRRWRDTSTLRPRTRESNYSFMLRTGIWLTREQPWVSSPVDWNTSTCAA
VIAAIDRMTVGEWALESALGTKLKGLGQAIAPNSKRAFLHALRRFFIDFELWGWGRLKFSP
RHYLATPRTVAFNSGINPRVIDDSSWLKLVWASLNLERKDLLSEIHYPLAMVQAAAVVWTH
TGLRSNEIMRLSMGCAHAQLHEVVHEDGTTIPPETLCYLDIPASKTFKAFVKPVAVVVKERI
DAWLKERPVNQAPLLDERTGEKVSYLFQFRGKRMGVGVINRTIIPMLCAKAGVPLDDSRG
RITSHRGRASVVTALASVPQGMSLMELMQWSGHSSPSSTLHYIRIRPTKLAASFVKADQM
SHMVSVLIDHDVIARRSSDPYTFYDLGDSYCSNPFWSSCPHRMACAGCDFNIPKASARA
QALESKASIGHYLEAVPLTADERAIVEGDLEKLDGLIRKLDDVPTLDGRTPSQIEAKKHR"

 Jens Boch
Martin-Luther-Universitat Halle-Wittenberg
PSPTOA0073 5-18-06: Gene feature added
gene            19220..19279                    
/locus_tag="PSPTO_A0073"                    
/note="This region contains a match to at least one other gene that is not full length, and is not the result of a sequencing artifact; ultraviolet light resistance protein RulB, truncation; identified by sequence similarity; putative"		 Jens Boch
Martin-Luther-Universitat Halle-Wittenberg
PSPTOA0015 5-18-06: Product name changed
Product name changed from "conserved hypothetical protein" to "plasmid partition protein ParB, truncated" based on sequence similarity
Jens Boch
Martin-Luther-Universitat Halle-Wittenberg
PSPTOA0016 5-18-06: Coordinates changed
Coordinates changes from 18949..19242 to 18865..19242 based on sequence similarity
Jens Boch
Martin-Luther-Universitat Halle-Wittenberg
PSPTOA0017

3-06: Gene name added and product name changed
Gene name "shcO1" added. Product name changed from "hypothetical protein" to "type III chaperone ShcO1"
Reference (PMID: 15937188)

M. Lindeberg
Cornell University
Based on literature review
PSPTOA0012

3-05: Nomenclature
Gene name changed from "avrPphE(Pto)" to "hopX1". Product name changed from "avirulence protein AvrPphE(Pto)" to "type III effector HopX1"
Note changed to: "Also known as AvrPphE; similar to GP:571514; identified by sequence similarity; putative"
Reference (PMID: 15828679)

 M. Lindeberg,
Cornell University
PSPTOA0005

3-05: Nomenclature
Gene name changed from "avrPpiB2(Pto)" to "hopAM1-1". Product name changed from "avirulence protein AvrPpiB2(Pto)" to "type III effector HopAM1-1"
Note changed to: "Also known as AvrPpiB2; similar to GP:886702; identified by sequence". Reference (PMID: 15828679)

M. Lindeberg,
Cornell University
PSPTOA0018

3-05: Nomenclature
Gene name changed from "hopPtoS1" to "hopO1-1". Product name changed from "type III effector HopPtoS1" to "type III effector HopO1-1"
Note changed to: "Previously known as HopPtoO (PMID 11872842; Guttman et
al, 2002) and HopPtoS1 (PMID 12032338; Petnicki-Ocwieja et al, 2002); similar to GP:19071512; identified by sequence similarity; putative". Reference (PMID: 15828679)

M. Lindeberg,
Cornell University
PSPTOA0019

3-05: Nomenclature
Gene name changed from "hopPtoT1" to "hopT1-1". Product name changed from "type III effector HopPtoT1" to "type III effector HopT1-1"
Note changed to: "Previously known as ORF16 (PMID 12032338;
Petnicki-Ocwieja et al, 2002), HolPtoU (PMID 11872842;
Guttman et al, 2002) and HopPtoT (PMID 14702323; Schechter, 2004); similar to GP:19071526; identified by sequence similarity; putative". Reference (PMID: 15828679)

M. Lindeberg,
Cornell University