|
The purpose of this
tutorial is to introduce new users to some of the tools in Artemis that are most
relevant to analyses of the P .syringae genomes. A more comprehensive description
of Artemis capabilities is available in the Artemis
manual available at the Sanger Institute website. Answers to some questions
are also available at Artemis FAQ for PPI users. Though this tutorial was written for early versions of Artemis, the steps described apply to subsequent versions.
Note
to Mac users: this tutorial has been designed using Artemis run on Windows.
However, all of the concepts described here are applicable to use of Artemis run
on the Mac. For specific instructions related to use on the Mac, see Tips
for Mac users. I.
Artemis terminology and file format II.
Obtaining the Artemis program and Artemis-readable files III.
Visualizing preexisting entries and their features
A. Starting
the Artemis program B. Locating features of interest using
the Goto menu C. Visualizing feature properties using
the View menu IV.
Creation of new entry files A.
creating and naming a new entry file B. selecting and moving
features into your new entry V.
Changing colors and other display properties VI. Creating
and formatting new features VII.
Tips for Mac users I.
Artemis terminology and file format A.
Terminology
| Entry |
a file specifying a DNA
sequence and/or one or more features in Genbank or EMBL format. Entries which
do not contain sequence are generally referred to as feature tables or tab files |
| Feature |
a unit of information describing
some aspect of the genome. Examples include: gene, CDS, promoter, operon |
| Key |
the term in the entry file
specifying the type of feature. Examples include,"gene" and "CDS"
(see sample entries below) | |
Location |
genome coordinates of the
feature. Given on the same line as the key (see sample entries below) |
| Qualifiers |
terms specifying additional
information about the feature. They are listed below the location and delimited
by / and =. Examples include gene, note, product, and translation. |
- B.
File format
Sequence files must be in FASTA format Files specifying features must be in
either Genbank or EMBL format Sample
entry specifying the first two features of the DC3000 chromosome in EMBL format:
| FT | source | 1..6397126 |
| FT | | /organism="Pseudomonas
syringae pv. tomato str. DC3000" | | FT | | /strain="DC3000" |
| FT | | /db_xref="taxon:223283" |
| FT | | /note="pathovar:
tomato" | | FT | gene
| 339..1874 |
| FT | |
/gene="dnaA" | | FT | |
/note="locus_tag: PSPTO0001" | | FT | CDS | 339..1874 |
| FT | |
/gene="dnaA" | | FT | | /codon_start=1 |
| FT | |
/transl_table=11 | | FT | | /product="chromosomal
replication initiator protein DnaA" | | FT | | /protein_id="NP_789863.1" |
| FT | |
/db_xref="GI:28867244" | | FT | | /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPN |
| FT | | RFVLDWVNEKYLGRLLELLGERGQGMAPALSLLIGSKRSSAPRAAPNAPLAAAASQAL |
| FT | | SGNSVSSVSASAPAMAVPAPMVAAPVPVHNVATHDEPSRDSFDPMAGASSQQAPARAE |
| FT | | QRTVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGV |
| FT | | GLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDAL |
| FT | | LIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGL |
| FT | | TVAVEPPELETRVAILMKKADQAKVDLPHDAAFFIAQRIRSNVRELEGALKRVIAHSH |
| FT | | FMGRDITIELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARP |
| FT | | RQVAMALSKELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLLRT |
| FT | | LTT" |
Sample
Entry specifying the two features listed above in Genbank format:
| FEATURES | location/qualifiers |
| source | 1..6397126 |
| | /organism="Pseudomonas
syringae pv. tomato str. DC3000" | | | /strain="DC3000" |
| | /db_xref="taxon:223283" |
| | /note="pathovar:
tomato" | | gene
| 339..1874 |
| |
/gene="dnaA" | | |
/note="locus_tag: PSPTO0001" | | CDS | 339..1874 |
| |
/gene="dnaA" | | | /codon_start=1 |
| |
/transl_table=11 | | | /product="chromosomal
replication initiator protein DnaA" | | | /protein_id="NP_789863.1" |
| |
/db_xref="GI:28867244" | | | /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPN |
| | RFVLDWVNEKYLGRLLELLGERGQGMAPALSLLIGSKRSSAPRAAPNAPLAAAASQAL |
| | SGNSVSSVSASAPAMAVPAPMVAAPVPVHNVATHDEPSRDSFDPMAGASSQQAPARAE |
| | QRTVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGV |
| | GLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDAL |
| | LIDDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGL |
| | TVAVEPPELETRVAILMKKADQAKVDLPHDAAFFIAQRIRSNVRELEGALKRVIAHSH |
| | FMGRDITIELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARP |
| | RQVAMALSKELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLLRT |
| | LTT" |
As illustrated above,
most loci have been assigned two features - one specifying the gene and the other,
the Coding Sequence (CDS).
II.
Obtaining the Artemis program and Artemis-readable files
Users can choose between two basic options for viewing sequences in Artemis: Option
1: Deploy Artemis over the network without downloading either the program
or the sequence, as described in: Tools
for Genome Analysis - Search and view with the Artemis Genome Viewer (quick version)
Pros:
Easiest approach for computing or bioinformatics novices. Users have ready access
to the latest version of Artemis and the most up-to-date genome sequences available
at NCBI and EBI Cons: Requires that your computer have Java Webstart
capability and a high speed internet connection
Option
2: Download Artemis and the genome sequences to your hard drive as
described below: - Create
an Artemis folder or directory on your local system
- Running
Artemis requires a Java platform. Mac OS X and Windows XP come with Java pre-installed,
but if you are using another operating system, you may need to install Java before
running Artemis. Instructions for downloading the version of Java
appropriate to your system can be accessed through the Sanger website.
- Download
the version of
Artemis appropriate for your system from the Sanger website to your Artemis
folder. Mac users: see Tips for Mac users.
TIP:
Artemis should download as a application file with a .jar extension. If you
receive a ZIPed folder when downloading from WWW, try downloading again from the
FTP site. Alternatively, you can manually delete the .zip extension and select
a non-compressed format before saving to your hard drive.) - Open
the sequence file of interest and save as a text file (with extension .txt, .gbk
or .tab) to your Artemis folder. RefSeq accession numbers in the table below are
hyperlinked to the corresponding files at the RefSeq FTP site. Users are advised
to download sequence from FTP sites, as the hyperlinks present in other file formats
interfere with file loading by Artemis.
TIP:
If you have difficulty
loading the sequence into Artemis, open the text file and verify that the entire
sequence was successfully downloaded. | Sequence/Entry | EBI/Genbank
accession | RefSeq
accession | | Pto
DC3000 chromosome | AE016853 |
NC_004578 |
| Pto DC3000
pDC3000A | AE016855 |
NC_004633 |
| Pto DC3000
pDC3000B | AE016854 | NC_004632 |
| Psy B728a
chromosome | CP000075 |
NC_007005 |
| Psp 1448A
chromosome | CP000058 |
NC_005773 |
| Psp
1448A p1448A-A | CP000059 | NC_007274 |
| Psp 1448A
p1448A-B | CP000060 |
NC_007275 |
III.
Visualizing preexisting entries and their features
A.
Starting the Artemis Program 1.
Click on the Artemis application. The window pictured immediately below will appear
(Figures below are taken from Artemis v5 but are generally applicable to later
versions.) 
2.
Go to File>Open and select your sequence file. A window similar to the one
below will appear (DC3000 genome sequence and annotation are shown in the example
below): 
B.
Locating features of interest using the Goto menu:
Bring
up the Navigation window using Goto>Navigator or Ctl-G. Enter a search term.
- Double
clicking on a feature will select it in all three windows (hold down the shift
key to select more than one feature).
- Go
to the beginning and end of of selected feature(s) using Ctl-left arrow and Ctl-right
arrow
- Go to
the beginning and end of the genome using the Ctl-up arrow and Ctl-down arrow
C.
Visualizing feature properties using the View menu:
View the entire record for
the selected feature using Ctl-V or View>View Selected Features View>View
Selection brings up a window showing the entire record PLUS base content, % GC,
1st and last 300 bps and translation (shown below)
Other useful
commands: - Ctl-W
displays hydrophobicity plots
- The
View menu allows display of bases and amino acids in FASTA format which can be
copied and pasted into BLAST windows
- The
Write menu enables sequences to be saved to files
(TIP: you may
have to add a .txt extension to the file after it has been saved to your hard
drive before it can be opened)
IV.
Creation of new entry files containing features from the full annotation
One of the greatest assets
of Artemis is that the user can create entry files containing lists of genes or
other features of interest, that can be color coded so they can be easily viewed
in their genomic context. - Preexisting
entry files corresponding to many of the major virulence genes are available for
downloading can be found at genome analysis tools.
- The following
steps describe how to create novel entry files.
A.
Creating and naming a novel entry file - Create>"New
entry" (a new entry entitled "no name" will appear on the entry
line near the top of the Artemis display)
- Entries>"Set
name of entry". (Select the entry "no name" and type in your name
of choice followed by a .txt or .tab extension)
- File>"Save
an entry" (select the new entry for saving)
You now have an empty entry
file to which you can save features of your choosing B.
Select and move features into your new entry If
you are moving only a small number of features to your new entry:
- Select features individually
(you can select more than one by holding the shift key)
- Edit>"Copy
selected features to" ( copies selected features into the entry file of choice)
- File>"Save
an entry" (saves the entry you select)
TIP:
avoid using File>"Save all entries". If Artemis crashes while saving,
you may lose data even from those files which were not changed Selection
of a large number of features can be done using the Feature selector option:
Example
1. Select coding sequences involved in alginate biosynthesis:
- Select>"Feature
selector.." (selects features based on their shared qualifiers) In this example,
I am selecting coding sequences for which the "product" qualifier contains
the word "alginate" (see
window at right)
- click
on Select
- click
on View (brings up a window showing the list of selected features)
- Select
desired features on the list
- Edit>"Copy
selected features" (specify the entry file to which they will be copied)
|  |
| Example
2. Select genes involved in alginate biosynthesis - Select>"Feature
selector.." using the following selection terms:
Key = gene
Qualifier = gene Containing this text = alg - Proceed
as described in Example 1.
| V.
Changing colors and other feature display properties
The default color for all "gene" and "CDS" features has
been set to white (or white and turquoise if you are launching Artemis from the
Sanger site. However, viewing multiple feature files simultaneously is greatly
simplified by color coding the individual files. The feature files available for
downloading from the genome analysis tools page
are colored through addition of color qualifiers added to the individual gene
and CDS features. These colors can be altered in one of the following ways:
- Open the feature file in
a program with a text editor (Word will work fine). Search for the existing RGB
coordinates and replace with the coordinates corresponding to your color of choice.
RGB coordinates for various colors can be found in the options file or in the
color settings in programs such as Powerpoint.
- To
change feature colors (or any other qualifier) in Artemis:
-
Select the feature(s) you wish to change.
- Go
to Edit>Change qualifiers of selected...
- In
the window that appears, select "colour" from the pull down menu and
click on "Insert qualifier"
- Type
the 3-number RGB coordinate after "/colour=" (see table below for RGB
coordinates)
- Click
on either "add" or "replace". Selecting "Add" will
leave any previous color qualifiers in place. The color shown corresponds to the
last one listed in the feature record.
| Color | RGB
coordinates | Color | RGB
coordinates | | white | 255
255 255 | brown | 200
150 100 | | dark
grey | 100
100 100 | pink | 255
200 200 | | red | 255
0 0 | light
grey | 170
170 170 | | green | 0
255 0 | black | 0
0 0 | | blue | 0
0 255 | light
steel blue | 176
196 222 | | cyan | 0
255 255 | purple | 178
58 238 | | magenta | 255
0 255 | tomato | 255
99 71 | | yellow | 255
255 0 | lemon
chiffon | 255
250 205 | | pale
green | 152
251 152 | turquoise | 0
245 255 | | sky
blue | 135
206 250 | plum | 238
174 238 | | orange | 255
165 0 | brick
red | 139
58 58 |
VI.
Creating and formatting new features A.
Select the region to be included in a new feature by one of the two following
methods - Highlight
an area in the Artemis window using the mouse
Create>"Create feature
from base range" - Create
a new feature by manually specifying the base range
- Create>"Create
feature from base range"
- Manually
type in the base range in the #..# format
B.
Format the new feature: Key
- Select a key term from the pulldown menu Location
- after entering the base range, the complement button can be used to specify
the complementary strand Qualifier - Select
desired qualifier from the pulldown menu and type relevant information between
the "". (Note is a good choice for general information) An
example of a feature in create/edit mode is shown below:
To add additional
base ranges to the feature, highlight an area or select another feature Click
"Grab Range" and the base range will be added to your feature A
line will appear linking the different components in the Artemis display
Use Ctl-V to verify that your feature has been formatted to your liking The
feature can be subsequently edited using the Edit menu VII.
Tips for Mac Users Macintosh
users with MacOS X (i.e. MacOS version 10) or better do not need to install Java
because it comes as a standard feature of the operating system. Sanger
suggests that Mac OS X users download the UNIX/Linux version of Artemis (see suggestions
for Mac OS X users in Tips
and FAQs). However, for those less familiar with UNIX, Artemis for Windows
is easily downloaded and fully functional on OS X. Note that when downloaded onto
a Mac, the Artemis program is renamed"Diana". The
Artemis window on the Mac differs somewhat from the sample windows displayed above,
with the chief differences being (i) the location of the pull-down menu and (ii)
shortcuts utilize the Mac Command key instead of the Ctl key. However, all the
functions described above are preserved. |